Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals >

Organic Salt

Organic Salt

All Organic Salt wholesalers & Organic Salt manufacturers come from members. We doesn't provide Organic Salt products or service, please contact them directly and verify their companies info carefully.

Total 2637 products from Organic Salt Manufactures & Suppliers
Buy cheap PEG Pharmaceutical Powder Peptide Steroid Hormones MGF For Weight Loss product

Brand Name:Chembj-Steroid

Model Number:PEG MGF

Place of Origin:China

98% PEG MGF White Pharmaceutical Powder Peptide Steroid Hormones MGF For Weight Loss Quick Detail; Product Name: PEG MGF Customized: Customized Purity: >98% Molecular Formula: C121h200n42o39 Appearance: White Powder Specification: USP/EP HS Code: ...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Buy cheap RoSh 3-Dots Sensitive Cobalt Free Humidity Indicating Cards Brown To Green product

Brand Name:SHMM

Model Number:HIC01,02,03,04,05,06

Place of Origin:Shanghai China

RoSh 3-Dots Sensitive Cobalt Free Humidity Indicator Card Brown To Green 1. Brief Allow a quick and low cost inspection of whether the humidity level is safe Lead-free RoHS compliant. Reversible color change, OEM allowed 2. Application Printed Circuit ...

Shanghai Hengyuan Macromolecular Materials Co.,Ltd.
Verified Supplier

Shanghai

Buy cheap Pirfenidone Pharmaceutical Raw Materials , Anti Inflammatory Powder Supplements  product

Brand Name:YUANYANG

Model Number:CAS: 53179-13-8

Place of Origin:China

Anti-Inflammatory Pharmaceutical Raw Powder Pirfenidone Powder Description: Pirfenidone is an orally active small molecule drug that may inhibit collagen synthesis, down regulate production of multiple cytokines and block fibroblast proliferation and ...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Polypeptide Pharmaceutical Raw Materials PEG-MGF Promote Growth Factor Bodybuilding product

Brand Name:YIJING

Model Number:PEG-MGF

Place of Origin:China

Pharmaceutical Raw Materials Polypeptide PEG-MGF Promote Growth Factor Bodybuilding Product introduction: PEG-MGF ; MGF; MGF,PEG-MGF,peg-mgf, PEGylated,MGF For Mechano M. F: C121H200N42O39 Purity (HPLC): 99.5.0% Single Impurity(HPLC): ≤ 0.5% Amino Acid ...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier

Shanghai

Buy cheap Testosterone Steroids Pharmaceutical Testosterone Undecanoate For Bodybuilding product

Brand Name:steroidphoebe

Model Number:5949-44-0

Place of Origin:China

Testosterone Steroids Pharmaceutical Testosterone Undecanoate For Bodybuilding Testosterone undecanoate (Steroids) Test unde Testosterone undecanoate Testosterone unde Test undecanoate Test unde 98% min. Test unde CAS NO.: 5949-44-0 English Synonyms: ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Buy cheap Local Anesthesia Drugs Dimethocaine Hydrochloride CAS 553-63-9 Pharmaceuticals product

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Local Anesthesia Drugs Dimethocaine Hydrochloride CAS 553-63-9 Pharmaceuticals Product Name: Dimethocaine Hydrochloride Synonyms: Larocaine hydrochloride;Dimethocaine hydrochloride;1-Propanol, 3-(diethylamino)-2,2-dimethyl-, 1-(4-aminobenzoate), ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap led strip aluminum extrusion, LED profile for shelves product

Brand Name:koner

Model Number:AL-M004

Place of Origin:china

Aluminum LED Profiles designer& Manufacturer; Linear LED Strip Profiles are the excellent option to take your LED light Strip installations to the next level. kinds of Aluminum LED profile with frosted diffusor used for led strips, 1- Anodized extrusions ...

KONER LTD
Active Member

Buy cheap Sodium formate 95% product

Price:USD290/mt FOB Tianjin

Packaging Details:25kg/pp bag

Delivery Time:within one week

Sodium Formate CAS No 141-53-7 Molecular Formula CHNaO2 Molecular Weight 68.01 Appearance White Crystal Powder Purity. % ,min. 92.0-94.3 Organic impurities ,wt. % ,min. 2.0 Moisture,wt. % ,max. 2.0 Chloride ,wt. % ,max. 1.0 Introduction Sodium formate is ...

Chems Co., Ltd.-RYCCL
Site Member

Guizhou

Buy cheap EP Healthy Muscle Building Red Injectable Steroids RIP Cut 175 mg/ml Liquid product

Brand Name:Muscle Man

Model Number:ychz04@chembj.com

Place of Origin:China

EP Healthy Muscle Building Injectable Red Steroids RIP Cut 175 mg/ml Liquid 1. Product details RIP Cut 175 mg/ml Each 1 ml of Rip Cut 175 contains: 75 mg of Testosterone Propionate; 50 mg of Trenbolone Acetate; 50 mg of Drostanolone Propionate 1) Masteron...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap Bodybuilding Steroids Raw Powder Testosterone Enanthate CAS 315-37-7 Test E product

Brand Name:JNJG

Model Number:Primoteston-Depot

Place of Origin:CHINA

Specification: Product Name Primoteston-Depot Primoteston-Depot Alias Testosterone Enanthate Primoteston-Depot CAS 3704-09-4 Primoteston-Depot MF C20H30O2 Primoteston-Depot MW 302.4558 Apperance white crystalline powder EINECS 206-253-5 Usage ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Buy cheap Printed Pineapple Tree Clutch Bag black assorted color block handbag for lady Small messenger bag with chain handle product

Brand Name:Customized Logo

Model Number:ZD1807

Place of Origin:Guangzhou China

Printed Pineapple Tree Clutch Bag black assorted color block handbag for lady Small messenger bag with chain handle Guangzhou Anbo Industry Co., Ltd. was establised in 2008, is specialized in Manufacturing. Its 15 kilo meters away from Baiyun Airport and ...

Guangzhou Anbo Industry Co.,Ltd.
Active Member

Buy cheap Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage product

Brand Name:Sendi

Model Number:ycwlb045@yccreate.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Powerful Equipoise Boldenone Powder , Reliable Equipoise Boldenone Hormone product

Brand Name:CZG

Model Number:ST27

Place of Origin:China

Hormone Steroid CAS 13103-34-9 Equipoise EQ Boldenone Undecylenate Product Description Equipoise / Boldenone Undecylenate for a cutting cycle will find they are more vascular than without, possess a grainier look as well are able to maintain more muscle ...

ChangZhou General Imp&Exp Co,.LTD
Verified Supplier

Jiangsu

Buy cheap Colorless Liquid Butyl Benzoate , CAS 136-60-7 99% Purity For Flavour And Fragrance product

Brand Name:BYT

Place of Origin:Shandong,China

Butyl Benzoate CAS NO.136-60-7 99% Purity Colorless to Light Yellow Liquid CAS NO 136-60-7 Catalog No ZCF05055 Synonyms n-Butyl benzoate Molecular Formula C11H14O2 Molecular Weight 178.23 Purity 98% mp -22 °C bp 250 °C Fp 223 °F Density 1.01 g/mL ...

Wuhan Biet Co.,Ltd
Verified Supplier

Hubei

Buy cheap Auto Conveyor Metal Detector 3020 (for bottle packing product inspection) product

Model Number:JL-IMD/M4012

Place of Origin:China

Metal detector,metal detectors machine,industrial metal detector,food metal detector,meat metal detector,chicken metal detector,fish metal detector,toy metal detector,tunnel metal detector,digital metal detectors machine,belt metal detector,conveyor metal...

JINLONG INDUSTRIAL CO.,LTD.
Site Member

Shanghai

Buy cheap Solid Urea Formaldehyde Resin Powder , Urea Moulding Powder Wear Resistance product

Brand Name:HONINGLITE

Model Number:UF1P-C5

Place of Origin:CHINA

Urea Moulding Compound Compression Grade in Powder for Molding Household handles Product description Urea Moulding compound are produced from Urea-formaldyde resion with cellulose fillers and are available in an unlimited range of colors. Parts moulded ...

Jiaxing Honing Import&Export CO,.LTD
Verified Supplier

Zhejiang

Buy cheap Fitness Muscle Growth Masteron Propionate for Sportsman Pharmaceutical Grade Steroids product

Brand Name:wumeitech

Model Number:521-12-0

Place of Origin:China

Fitness Muscle Growth Masteron Propionate for Sportsman Pharmaceutical Grade Steroids Drostanolone Propionate Details: Product Name Drostanolone Propionate DrostanolonePropionate Alias Masteron; Dromostanolone Propionate DrostanolonePropionate Purity 99%...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap CAS 51022-70-9  Pharmaceutical Ingredient Salbutamol Sulfate Albuterol Sulfate Fitness Steroids product

Brand Name:HKYC

Model Number:99%

Place of Origin:CHINA

CAS: 51022-70-9 Pharmaceutical Ingredient Salbutamol Sulfate Albuterol Sulfate Fitness Steroids Quick Detail: Product Name: Albuterol Sulfate Alias: Ventolin; Proventil CAS: 51022-70-9 MF: (C13H21NO3)2·H2SO4 MW: 576.71 EINECS: 242-424-0 Storage: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap CAS 50-50-0 Pharmaceutical Raw Materials Estradiol Benzoate Raw Powder product

Brand Name:Kafen

Model Number:50-50-0

Place of Origin:China

Estradiol benzoate Synonyms:N-oxidation of rifampicin (3 - hydroxy-female steroid -1,3,5 (10) - triene-17b-ol -3 - benzoic acid ester) CAS NO: 50-50-0 Molecular Formula: C25H28O3 Molecular Weight: 376.49 Content: 99% Physical Properties: white or slightly...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap CAS 862-89-5 Factory Direct Supplying Nandrolone Undecylate for Bodybuilding product

Brand Name:Gear Steroids

Model Number:862-89-5

Place of Origin:CHINA

High Quality CAS 862-89-5 Factory Direct Supplying Nandrolone Undecylate for Bodybuilding 1, Quick Detail Model NO.: 862-89-5 Customized: Customized Suitable for: Elderly, Children, Adult Purity: >99% Synonyms: Nandrolone Undecanoate Mf: C29h46o3 Usage: ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Go to Page
Inquiry Cart 0