Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Printing Inks >

Steroid Injection For Carpal Tunnel

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    steroid injection for carpal tunnel

    All steroid injection for carpal tunnel wholesalers & steroid injection for carpal tunnel manufacturers come from members. We doesn't provide steroid injection for carpal tunnel products or service, please contact them directly and verify their companies info carefully.

    Total 121 products from steroid injection for carpal tunnel Manufactures & Suppliers
    Buy cheap Weight Loss Peptides HGH Fragment 176-191, Injectable Fat Burning Supplements product

    Brand Name:LSW

    Model Number:HGH Fragment 176-191

    Place of Origin:China

    ...Weight Loss Peptides HGH Fragment 176-191, Injectable Fat Burning Supplements HGH Frag 176-191 is a fragment of the HGH peptide. Scientists found ...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders product

    Brand Name:Gear steroids

    Model Number:1045-69-8

    Place of Origin:China

    ...GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders CJC-1295 Peptide Profile CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap Jintropin Injection Human Growth Hormone Steroid For Muscle Building product

    Brand Name:Mking

    Model Number:Jintropin

    Place of Origin:Hubei, China

    ...Certified Bodybuilding HGH Injection Jintropin Human Growth Hormone Steroid Jintropin Description Growth hormone (somatropin) is one of the hormones secreted and produced by the ...

    Hubei Mking Biotech Co., Ltd.
    Verified Supplier

    Hubei

    Buy cheap Pharmaceutical Grade Steroids Health Care Supplement Vitamin B12 Cyanocobalamin VB12 product

    Brand Name:wumeitech

    Model Number:SARMs Powder

    Place of Origin:China

    ...Pharmaceutical Grade Steroids Health Care Supplement Vitamin B12 Cyanocobalamin VB12 Vitamin B12 Detail: Vitamin B12 (Cyanocobalamin) Synonyms: Rubramin ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Buy cheap 99% Purity Weight Loss Steroids Peptide Human Growth Fragment 176-191 2mg / Vial product

    Brand Name:www.steroidaily.com

    Model Number:service01@chembj.com

    Place of Origin:china manufactuer

    ...99% Purity Weight Loss Steroids Peptide Human Growth Fragment 176-191 2mg / Vial HGH fragment 176-191 Synonyms: Fragment 176-...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Buy cheap 12629-01-5 Human Growth Hormone Steroid Bodybuilding Somatropin 191aa product

    Brand Name:GB

    Place of Origin:China

    ...12629-01-5 Human Growth Hormone Steroid Bodybuilding Somatropin 191aa Human growth hormone: Up close and personal 1. Growth hormone (GH) is a small ...

    Hubei God bull Pharmaceutical Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Anti Estrogen CJC 1295 Peptides Steroids Supplements For Building Muscle / Fat Burning product

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ... Growth Hormone CJC 1295 W/O DAC Fat Loss 1. What is CJC 1295 CJC 1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone releasing hormone (GHRH) mimetic...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Buy cheap Fat Loss Steroids Fragment 176-191 2mg Soluble In Water Or Acetic Acid product

    Brand Name:HKYC

    Model Number:66004-57-7

    Place of Origin:China

    ...Fat Loss Steroids Fragment 176-191 2mg Soluble In Water Or Acetic Acid Email: ycgsales06@ycphar.com WhatsApp: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap CAS 12629-01-5 HGH Human Growth Hormone Muscle Building Injectable Anabolic Steroids product

    Brand Name:SR Health Tech

    Model Number:12629-01-5

    Place of Origin:China

    ...Injectable Steroids 99% Purity Human Growth Hormone, HGH White Lyophilized Powder Muscle Building Steroids CAS No. 12629-01-5 Profile: Human growth hormone is a remarkable hormone. It is secreted by ...

    Steroidraws Health Tech Company Limited
    Verified Supplier

    Hong Kong

    Buy cheap HGH Fragment 176-191 2mg/vial Natural Human Growth Peptide Hormones For Bodybuilder product

    Brand Name:DW

    Model Number:CAS No: 176-191

    Place of Origin:China

    Anabolic HGH 2mg/vial Natural Human Growth Peptide Hormones For Bodybuilding Email: joedoublewin@hotmail.com Skype: tonyself2000 Why is it so hard to find a reputable growth hormone source? Short answer Someone has been working very hard for years to ...

    Doublewin Biological Technology Co., Ltd.
    Verified Supplier

    Guangxi

    Buy cheap Healthy Anabolic Supplements Bodybuilding , Pure Male Enhancement Powder product

    Brand Name:Pharmlab

    Model Number:Anabolic steroids

    Place of Origin:China

    Anabolic Steroids About How These Drugs Work And How They Can Affect Your Health >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> Performance-enhancing drugs: Know the risks Are you hoping to gain a competitive edge

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap jintropin HGH 100iu for bodybuilding human Growth Hormone White Lyophilized Powder product

    Brand Name:HongKong Blue

    Model Number:Jintropin

    Place of Origin:CHINA

    ... sequence growth hormone, with much less E.coli protein contamination and no side effects associated with injection. Jintropin for injection causes the least amount of antibody formationafter one month...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Buy cheap Lab Supply Cjc 1295 Peptide Without DAC 863288-34-0 For Bodybuilding product

    Brand Name:JNJG

    Model Number:Cjc1295

    Place of Origin:CHINA

    Lab Supply Peptides Cjc-1295 Without DAC 2mg/Vial Powder For Bodybuilding Cjc-1295 Specification: Product Name Cjc1295 Cjc1295 Alias CJC1295 Without DAC Cjc1295 CAS 863288-34-0 Cjc1295 Molecular Formula C165H271N47O46 Cjc1295 Molecular weight 3649.30 ...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Buy cheap CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production product

    Brand Name:NJBN STEROID

    Model Number:863288-34-0

    Place of Origin:MADE IN CHINA

    Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Buy cheap CJC1295 With DAC powerful Peptides Bodybuilding growth muscle white powder product

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:china

    CJC1295 With DAC powerful Peptides Bodybuilding growth muscle white powder Basic Info CJC1295dac 2mg Per Vial From China CJC 1295 with DAC other name: CJC1295dac, CJC1295withDAC CAS No.:863288-34-0 Standard: Medicine Grade Classification: Brassinosteroid ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap Recombinant Human Growth Hormone For Injection Hygetropin Black Tops / Yellow Top Hygiene Hyge HGH product

    Brand Name:Hygene Biopharm

    Model Number:Hygetropin 8iu

    Place of Origin:China

    ...Recombinant human growth hormone for Injection hygetropin black tops vs yellow top hygiene hyge hgh Q1: yellow top hyges vs. black ...

    Marvel Pharma Inc.
    Active Member

    Hunan

    Buy cheap Fat Loss Steroids Fragment 176-191 2mg Soluble In Water Or Acetic Acid product

    Brand Name:HKGC

    Model Number:66004-57-7

    Place of Origin:China

    Specification: Product Name: HGH Fragment 176-191 Unit size: 5 mg/vial CAS NO.: 66004-57-7 Synonyms: HGH FRAG 176-191, frag 176 Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Purity: ≥98% (HPLC) Physical State: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Active Member

    Hong Kong

    Buy cheap Somatropin Lyophilized Powder Safest Injectable Steroids Ggrowth Hormone Somatotropin product

    Brand Name:KANGDISEN

    Model Number:freeze-dried powder

    Place of Origin:China

    ...Somatropin Lyophilized Powder Safest Injectable Steroids Ggrowth Hormone Somatotropin We can supply HGH raw material powder. Lyophilized powder, 3.7mg = 10 IU ...

    Hongkong Kangdisen Medical Co., Limited
    Active Member

    Hong Kong

    Buy cheap Weight Loss Peptides Steroids HGH Fragment 176-191, Injectable Fat Burning Supplements product

    Brand Name:JCJCHEM

    Model Number:HGH Fragment 176-191

    Place of Origin:China

    ...Weight Loss Peptides HGH Fragment 176-191, Injectable Fat Burning Supplements Descripyion: HGH Fragment (HGH Frag 176-191) is a peptide hormone of the ...

    JCJ Logis Co.,ltd
    Active Member

    Hubei

    Buy cheap HGH Fragment 176-191 Fat Burning Steroids White Powder 2mg / vials 99% Min Assay product

    Brand Name:LSW

    Model Number:10mg/vials,10vials/kit

    Place of Origin:China

    ...HGH Fragment 176-191 Fat Burning Steroids White Powder 2mg / vials 99% Min Assay HGH Frag 176-191 is a fragment of the ...

    Wuhan Lianshangwang Technology Co.,LTD
    Active Member

    Hong Kong

    Go to Page
    Inquiry Cart 0