Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Pharmaceuticals > Vitamins, Amino Acids and Coenzymes >

Sermorelin Acetate Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    sermorelin acetate side effects

    All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

    Total 2495 products from sermorelin acetate side effects Manufactures & Suppliers
    Buy cheap Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep product

    Brand Name:Yihan

    Place of Origin:China

    Model Number:86168-78-7

    ...Sermorelin Acetate GHRP Hormone Injection Peptides For Improving Sleep Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Buy cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate product

    Brand Name:YIHAN

    Model Number:Sermorelin

    Place of Origin:hina

    ... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap High Purity Muscle Growth Peptides , Sermorelin Acetate Bodybuilding GRF 1-29 product

    Brand Name:Hongxi Pharm

    Model Number:SARMs Powder

    Place of Origin:HongKong/China

    ...Sermorelin Acetate Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) Product Name Sermorelin Acetate Also known as Sermorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Buy cheap High Effective Peptide Hormone Sermorelin Acetate For Muscle Building CAS 86168-78-7 product

    Brand Name:bodybiological

    Model Number:CAS 86168-78-7

    Place of Origin:Hubei, China

    ...Effective Peptide Hormone Sermorelin Acetate For Muscle Building CAS 86168-78-7 GRF 1-29 Sermorelin is actually known to us by the name GRF (1-29). The original GFR (1-29) is, ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle product

    Brand Name:Saichuang

    Model Number:86168-78-7

    Place of Origin:China

    ... Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Buy cheap Sermorelin Acetate Muscle Building Peptides CAS 86168-78-7 With 99% Purity product

    Brand Name:TINGYI

    Model Number:CAS: 86168-78-7

    Place of Origin:CHINA

    ...What is Sermorelin? Also called as GRF 1-29, Sermorelin is GHRH derivative that contains first, active 29 amino acids chain of GHRH that promote release of growth hormones from the pituitary. Sermorelin forms...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    Buy cheap Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 product

    Brand Name:BestSteroid

    Model Number:2mg

    Place of Origin:Hubei,China

    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Buy cheap Sermorelin Acetate Local Anesthetic Powder CAS 86168-78-7 White Powder product

    Brand Name:Top Pharm

    Model Number:86168-78-7

    Place of Origin:China

    ...Peptides Sermorelin Acetate Cas No.86168-78-7 white powder Peptide series hot sell 2mg/vial Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Buy cheap Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss product

    Brand Name:Sermorelin Acetate

    Model Number:86168-78-7

    Place of Origin:SHANGHAI

    ...Sermorelin Acetate CAS : 86168-78-7 Human Growth Hormone HGH for Bodybuilding and Weight Loss​ Product Name: Sermorelin Acetate Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Buy cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder product

    Brand Name:Muscle Man

    Model Number:400

    Place of Origin:Hunan,China

    ...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    Buy cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH product

    Brand Name:KANGDISEN

    Model Number:2 mg/vial

    Place of Origin:China

    ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Buy cheap Sermorelin Acetate Powder product

    Place of Origin:China

    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

    Wuhan changdashun Technology Co., Ltd
    Active Member

    Hubei

    Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product

    Categories:API(Active Pharmaceutical Ingredients)

    Country/Region:china

    ... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe...

    Shenzhen YoungCom Biotech Co., Ltd.
    Site Member

    Guangdong

    Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product

    Brand Name:Youngshe

    Model Number:YSPI

    Place of Origin:Chengdu , China

    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

    Chengdu Youngshe Chemical Company
    Active Member

    Buy cheap Sermorelin Acetate product

    Place of Origin:China

    Sermorelin Acetate Cas no: 86168-78-7 Sermorelin is used in the treatment of prevention of HIV-induced weight loss, children with growth hormone deficiency or growth failure.

    Humans Technology Co.,Ltd
    Site Member

    Hubei

    Buy cheap Sermorelin Acetate product

    Brand Name:YC

    Place of Origin:wuhan china

    ...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

    Wuhan Yuancheng Gongchuang Technology Co.,Ltd
    Active Member

    Hubei

    Buy cheap Bodybuilding supplements peptide Sermorelin acetate 86168-78-7 Factory price fast shipping product

    Place of Origin:China

    ...Bodybuilding supplements Sermorelin acetate 86168-78-7 Factory price fast shipping Base information of Sermorelin acetate Chemical Name: Sermorelin acetate CAS No : 86168-78-7 Sequence :H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-...

    Hangzhou Mobel Biotechnology Co.,ltd
    Active Member

    Zhejiang

    Buy cheap GRF 1-29 NH2, Sermorelin Acetate Hydrate / skype:sucy1171 product

    Place of Origin:Made in China

    Brand Name:YC-WUMEI

    Model Number:WUMEI

    Contact :Sucy Skype:sucy1171 E -mail:sucy@ycphar.com Whatsapp:+8618872220809 http://www.servechemical.com 1.Quick Details: Usage: Our advantage: Related Products:

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Active Member

    Guangdong

    Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product

    Categories:API(Active Pharmaceutical Ingredients)

    Telephone:86-755-26879710

    Country/Region:china

    ... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe...

    Shenzhen YoungCom Biotech Co., Ltd.
    Site Member

    Guangdong

    Buy cheap Polypeptide Hormones Sermorelin For Increase Body Metabolism and Organs New Cells Growth product

    Brand Name:RAWSGEAR

    Model Number:86168-78-7

    Place of Origin:China

    ...Polypeptide Hormones Sermorelin For Increase Body Metabolism and Organs New Cells Growth Product name Sermorelin CAS No. 86168-78-7 MF C149H246N44O42S MW 3357.88 EINECS 1312995-182-4 storage temp −20°C Sermorelin is a GHRH...

    Wuhan Shuiyixing Pharmaceutical Chemical Co., Ltd.
    Site Member

    Hubei

    Go to Page
    Inquiry Cart 0