Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Incontinence Care >

Hgh 191 Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    hgh 191 side effects

    All hgh 191 side effects wholesalers & hgh 191 side effects manufacturers come from members. We doesn't provide hgh 191 side effects products or service, please contact them directly and verify their companies info carefully.

    Total 4775 products from hgh 191 side effects Manufactures & Suppliers
    Buy cheap Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects product

    Brand Name:HGH

    Model Number:2iu/6iu/10iu/vial * 10vials/kit

    Place of Origin:China

    ...Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects Description There are primarily two theories as to how hGH exerts its growth promoting effects. The first theory is called the Dual Effector...

    HongKong Amgen Biopharm CO.,LTD
    Verified Supplier

    Hong Kong

    Buy cheap Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect product

    Brand Name:hygetropin

    Model Number:C16H22Cl2N2O

    Place of Origin:china

    ...Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect Skype: live:leercsupplier Skype name:RC supplier Email : rcbossboy@gmail.com Whatsapp :+86 17045275682 Wickr :...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap Improved Hygetropin Hgh Human Growth Hormone Lyophilized Powder CAS 846-46-0 product

    Brand Name:SR

    Model Number:CAS 846-46-0

    Place of Origin:China

    ... Growth Hormone lyophilized powder 1)Details Description : Product Name HGH Jintropin CAS NO CAS106505-90-2 Apperance Lyophilized powder Delivery time Within 2 days after received payment ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap Pharmaceutical Raw Materials Nootropics Oxiracetam Powder Brain Metabolism Medicine No Side Effects product

    Brand Name:HKYC

    Model Number:62613-82-5

    Place of Origin:China

    ...Pharmaceutical Raw Materials Brain Metabolism Medicine Nootropics Oxiracetam NO Side Effects Quick Detail: Product name: Oxiracetam CAS No.: 62613-82-5 MF: C6H10N2O3 MW: 158.16 Appearance: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap Effective Standard Mestanolone Testosterone Powder Source For Male Hypogonadism Treatment product

    Brand Name:TJ

    Model Number:521-11-9

    Place of Origin:CHINA

    ...Name: Mestanolone CAS No: 521-11-9 Appearance: White Crystalline Powder Assay: 99% Effective Standard Mestanolone Testosterone Powder Source For Male Hypogonadism Treatment 99% Purity Mestanolone Hormone 99.37% ...

    zhuhai TianJian Chemical Co.,Ltd.
    Verified Supplier

    Guangdong

    Buy cheap HGH Fragment 176-191 Fat Burner Human Growth Peptides Releasing Peptide HGH For Fat Loss product

    Brand Name:Hongkong SaiChuang

    Model Number:158861-67-7

    Place of Origin:China

    ...HGH Fragment 176-191 injectable Human Growth Hormone Releasing Peptide HGH For Fat Loss 12629-01-5 Quick Details: Product Name: HGH Fragment 176-191 Synonyms: HGH 176-191, Fragment 176-191, Human Growth Fragment MF: C78H125N23O23S2 MW: 1817...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Somatropin Cartridges Injection Human Growth Hormone Peptide HGH Pen 36iu product

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ... influences sexual pleasure. HGH production slows down as you age. Jintropin from Gensci is the most popular human growth hormone (HGH) sold in China. Jintropin uses a secretion technology which produces a 191 amino acid

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Buy cheap Medical Peptide Protein Hormones Aod 9604 / Hgh Fragment 177 191 CAS 221231-10-3 product

    Brand Name:shinrezing

    Model Number:221231-10-3

    Place of Origin:China

    ...Product Description Frag 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS:221231-10-3 Appearance: White Powder Purity: 99% ...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap CAS 1379686-30-2 Effective SARM Supplements , Oral / Injectable SR9009 Stenabolic product

    Brand Name:XinRunde

    Model Number:1379686-30-2

    Place of Origin:China(Mainland)

    99% SR9009 Stenabolic 1379686-30-2 SARM Supplement Powder Strength Endurance 1, SR9009/ Stenabolic Profile: Product Name: SR9009 Alias: Stenabolic, SR-9009, SR 9009 Synonyms: Ethyl-3-(((4-chlorobenzyl)((5-nitrothiophen-2-yl)methyl)amino)methyl)pyrrolidine...

    Hubei XinRunde Chemical Co., Ltd
    Verified Supplier

    Hubei

    Buy cheap White lyophilized powder Human Growth Hormone HGH 191AA 10iu 15iu Steroids for Muscle Building product

    Brand Name:YIHAN

    Model Number:hgh 191aa

    Place of Origin:China

    ... Growth Hormone 10iu 15iu per vial Powder Quick Detail: Product Name HGH CAS NO CAS106505-90-2 Apperance Lyophilized powder Delivery time Within 2 days after received payment Minimum ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap HGH 191AA Human Growth Hormone Steroid 99% Purity Powder For Weight Loss product

    Brand Name:Global Chemical

    Model Number:HGH 191AA Blue Tops

    Place of Origin:China

    ...99% Human Growth HGH 191AA Blue Tops Hormone HGH Powder for Weight Loss 191AA HGH reviews HGH 191AA CAS:9002-72-6 Feature: high bioactivity, high stability, high purity, 191 aa Molecular formula: C990H1528N262O300S7 Formula weight...

    Global chemicals Co.,Ltd
    Verified Supplier

    Buy cheap strongest noid 5F-MDMB-2201 Pharmaceutical Raw Materials Safe Research Chemicals research chemicals,strong effect noids product

    Brand Name:5F-MDMB-2201 5f mdmb 2201

    Model Number:5F-MDMB-2201

    Place of Origin:CHINA

    ...strongest noid 5F-MDMB-2201 Pharmaceutical Raw Materials Safe Research Chemicals research chemicals,strong effect noids Skype&Whatsapp:+86 17045275602 Email:Arinachemicals@gmail.com Competive advantages 1.Rich experience We specialize ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Buy cheap Medicine Grade Purest 191AA HGH Hygetropin For Strong Big Mass White Freezed Powder product

    Brand Name:Bodybiological

    Model Number:Hygetropin

    Place of Origin:China

    ...Medicine grade purest 191AA HGH Hygetropin in white 100iu/kit,10iu/vial for Strong big mass Our History: Wuhan Body ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone product

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Buy cheap Lyophilized Powder Lose Weight Powder AOD 9604 Hgh 176-191 99% Purity product

    Brand Name:Pharmlab

    Model Number:221231-10-3

    Place of Origin:China

    ...Lyophilized Powder Peptides Hormones Steroids AOD 9604 hgh 176-191 for weight loss Quick detail Product name: AOD 9604 Other Name: hgh 176-191 CAS: 221231-10-3 Appearance: white lyophilized powder purity: 99% Trademark...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap 2mg/Vial Fat Loss Peptide HGH Fragment 176-191 for Muscle Growthing product

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    ... Peptide HGH Fragment 176-191 for Muscle Growthing GH Frag 176-191 Quick Details: Gh Fragment 176 191 Product Name GH Frag 176 191 Gh Fragment 176 191 Synonyms GH Fragment 176-191 Gh Fragment 176 191 CAS...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap Growth Hormone Peptide Fragment 176-191 Top Quality HGH 191 amino acids HGH wholesale product

    Place of Origin:Shen Zhen of China

    Brand Name:Fragment 176-191 HGH

    Model Number:HGH-23

    ... peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that the fat-reducing effects of GH...

    Hongkong HW Biotech Co.,Ltd.
    Site Member

    Yunnan

    Buy cheap Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone product

    Place of Origin:chemilytech@hotmail.com

    ...Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone We can supply them with High Quality,Low Price and Safe ...

    Humans Technology Co.,Ltd
    Site Member

    Hubei

    Buy cheap Human Growth Hormone 99% hgh 191 aa powder Somatropin  skype:alice.zhang595 product

    Brand Name:SVYA

    Model Number:SVYA-01

    Place of Origin:China

    Product Description Molecular Formula C78H125N23O23S2 Molecular weight 1817.12 Purity >99% Appearance lyophilized powder Related substance Total Impurities (%) <= 2.0% Acetate content <=15.0% Bacterial Endotoxins <=5 IU Purity 100% by RP-HPLC Stability 2 ...

    Hebei Shengweiya Biotechnology Co,.Ltd
    Active Member

    Hebei

    Buy cheap green top hgh,hgh 191 blue top hgh,generic greentop hgh product

    Place of Origin:China

    Model Number:Green top HGH-01

    ...Inquiry and order email: hghseller at hotmail.com Product name : Green top HGH Price : 70-105$/kit(order more, better price) MOQ: 1 kit Specification: 100iu/kit (10iu/vial, ...

    Super Human Growth Hormone Pharmaceutical Co.,Ltd
    Active Member

    Guangdong

    Go to Page
    Inquiry Cart 0