Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Health & Medical > Autoclave >

Hgh 191 Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    hgh 191 side effects

    All hgh 191 side effects wholesalers & hgh 191 side effects manufacturers come from members. We doesn't provide hgh 191 side effects products or service, please contact them directly and verify their companies info carefully.

    Total 7137 products from hgh 191 side effects Manufactures & Suppliers
    Buy cheap Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects product

    Brand Name:HGH

    Model Number:2iu/6iu/10iu/vial * 10vials/kit

    Place of Origin:China

    ...Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects Description There are primarily two theories as to how hGH exerts its growth promoting effects. The first theory is called the Dual Effector...

    HongKong Amgen Biopharm CO.,LTD
    Verified Supplier

    Hong Kong

    Buy cheap Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects product

    Brand Name:HGH

    Model Number:2iu/6iu/10iu/vial * 10vials/kit

    Place of Origin:China

    ...Anti Hair Loss Somatomedin hypothesis Anti Aging HGH Without Side Effects Description There are primarily two theories as to how hGH exerts its growth promoting effects. The first theory is called the Dual Effector...

    HongKong Biosuper Health Tech. Co., Ltd
    Verified Supplier


    Buy cheap Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect product

    Brand Name:hygetropin

    Model Number:C16H22Cl2N2O

    Place of Origin:china

    ...Medicine Grade Hygetropin Growth Hormone Powder Hgh Supplements Strong Effect Skype: live:6c01f49430a6f4d5 Skype :RC supplier Email : Whatsapp :+86 17045275682 Wickr :smithlee ...

    Linyi dingsheng chemical products Co., Ltd
    Verified Supplier


    Buy cheap HGH Human Growth Hormone for Increase Muscle HGH wholesale Jintropin product

    Brand Name:KUKE

    Model Number:CAS 12629-01-5

    Place of Origin:China

    ... Growth Hormone for Increase Muscle HGH wholesale Jintropin Email : SKype : live:miya_709 Details Description : Product Name Jintropin CAS ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier


    Buy cheap Medical Peptide Protein Hormones Aod 9604 / Hgh Fragment 177 191 CAS 221231-10-3 product

    Brand Name:shinrezing

    Model Number:221231-10-3

    Place of Origin:China

    ...Product Description Frag 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS:221231-10-3 Appearance: White Powder Purity: 99% ...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Buy cheap Supply 100% Purity HGH 176-191   Increases Muscle Growth And Muscle Strength product

    Brand Name:Yuanhang

    Model Number:Peptides

    Place of Origin:China

    ...Basic info. Product name:HGH 176-191 Synonyms: Fragment 177-191, AOD-9604 MF C78H123N23O23S2 MW 1815.08152 Appearance White Powder Purity 98% Grade Pharmaceutical Grade ...

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Buy cheap Injectable Jintropin 91AA Human Growth Hormone Fat Loss Anti Aging HGH No Side Effect product

    Model Number:10iu/vial, 100iu/box

    Place of Origin:China

    Brand Name:Generics

    ... pituitary gland produces because it is made by secretion technology that makes a 191 amino acid sequence. jintropin is an injectable human growth hormone of the highest grade. HGH which is naturally produced

    Hong Kong Super Hormone Pharma co., ltd
    Verified Supplier

    Hong Kong

    Buy cheap Supply HGH (Human Growth Hormone), Hygetropin 100IU (10IU/Vial 10Vials/kit), Hygetropin manufacturers product

    Brand Name:Hygetropin

    Model Number:Hygetropin

    Place of Origin:china

    ... being identical in structure to the body's own hGH, there is no risk the body will create antibodies to Hygetropins Hormone consisting of 191 amino acids. In humans it is produced in...

    Global chemicals Co.,Ltd
    Verified Supplier

    Buy cheap CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone product

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier


    Buy cheap Lyophilized Powder Lose Weight Powder AOD 9604 Hgh 176-191 99% Purity product

    Brand Name:Pharmlab

    Model Number:221231-10-3

    Place of Origin:China

    ...Lyophilized Powder Peptides Hormones Steroids AOD 9604 hgh 176-191 for weight loss Quick detail Product name: AOD 9604 Other Name: hgh 176-191 CAS: 221231-10-3 Appearance: white lyophilized powder purity: 99% Trademark...

    Pharmlab Co.,Ltd
    Verified Supplier


    Buy cheap Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results product


    Model Number:106612-94-6

    Place of Origin:China

    ...Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results Wuhan Lianshangwang Technology Co.,LTD Contact person:helena liu whatsapp:+86 ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier


    Buy cheap 2mg/Vial Fat Loss Peptide HGH Fragment 176-191 for Muscle Growthing product

    Brand Name:HBYC

    Model Number:HBYC

    Place of Origin:China

    ... Peptide HGH Fragment 176-191 for Muscle Growthing GH Frag 176-191 Quick Details: Gh Fragment 176 191 Product Name GH Frag 176 191 Gh Fragment 176 191 Synonyms GH Fragment 176-191 Gh Fragment 176 191 CAS...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap 2mg/vial HGH fragment 176-191 Injectable Human Growth Peptides AOD9604 For Fat-loss product

    Brand Name:Keray

    Model Number:221231-10-3

    Place of Origin:China

    ...HGH fragment 176-191 (2mg/vial) Basic information: HGH fragment 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS 221231-10-3 Appearance: White Powder Purity: 98% ...

    Shenzhen Keray Biotech Co., Ltd.
    Verified Supplier


    Buy cheap No Side Effects Pharmaceutical Raw Materials Nootropics Oxiracetam Brain Metabolism Medicine product

    Brand Name:HKYC

    Model Number:62613-82-5

    Place of Origin:China

    ... Whatsapp: +86 18144979254 QQ: 2355935220 Pharmaceutical Raw Materials Brain Metabolism Medicine Nootropics Oxiracetam NO Side Effects Quick Detail: Product name: Oxiracetam CAS No.: 62613-82-5 MF: C6H10N2O3 MW: 158.16 Appearance...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Buy cheap Igtropin HGH IGF-1 Long R3 Peptide Steroid Hormones 99.8% purity For Bodybuilding product

    Brand Name:HY

    Model Number:HGH

    Place of Origin:CN

    ...Buy Wholesale Igtropin HGH IGF-1 Long R3 Peptide Steroid Hormones For Bodybuilding Contact: Skype:jhonrcbest 1.igf-1 ...

    Hongyu Chemical Co.,Ltd.
    Verified Supplier


    Buy cheap High quality bodybuilding Somatropin Cartridges Somatropin injection Human Growth Hormone HGH pen product

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ... that stimulates the growth of muscles and bones, helps regulate metabolism and influences sexual pleasure. HGH production slows down as you age. Jintropin from Gensci is the most popular human growth...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Buy cheap Growth Hormone Peptide Fragment 176-191 Top Quality HGH 191 amino acids HGH wholesale product

    Place of Origin:Shen Zhen of China

    Brand Name:Fragment 176-191 HGH

    Model Number:HGH-23

    ... peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that the fat-reducing effects of GH...

    Hongkong HW Biotech Co.,Ltd.
    Site Member


    Buy cheap Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone product

    Place of

    ...Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone We can supply them with High Quality,Low Price and Safe ...

    Humans Technology Co.,Ltd
    Site Member


    Buy cheap green top hgh,hgh 191 blue top hgh,generic greentop hgh product

    Place of Origin:China

    Model Number:Green top HGH-01

    ...Inquiry and order email: hghseller at Product name : Green top HGH Price : 70-105$/kit(order more, better price) MOQ: 1 kit Specification: 100iu/kit (10iu/vial, ...

    Super Human Growth Hormone Pharmaceutical Co.,Ltd
    Active Member


    Buy cheap Fat loss and body building generics HGH 191 amino acid, improved heart and kidney function product

    Place of Origin:China

    Brand Name:Generics

    Model Number:10iu/vial, 100iu/box

    ...Fat loss and body building generics HGH 191 amino acid, improved heart and kidney function Competitive Advantage: 14% average decrease in fat 8.8% average ...

    Hongkong Super Hormones Bio-tech Co., ltd.
    Active Member


    Go to Page
    Inquiry Cart 0