Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home >

Cas No 141732 76 5

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cas no 141732 76 5

    All cas no 141732 76 5 wholesalers & cas no 141732 76 5 manufacturers come from members. We doesn't provide cas no 141732 76 5 products or service, please contact them directly and verify their companies info carefully.

    Total 18 products from cas no 141732 76 5 Manufactures & Suppliers
    Buy cheap 98% USP Grade Growth Hormone Peptides Exenatide Acetate Raw Powder CAS 141732-76-5 product

    Brand Name:Doublewin

    Model Number:141732-76-5

    Place of Origin:China

    ...Exenatide Acetate Peptide for Adult CAS 141732-76-5 Product Name: Exenatide Acetate (Exendin-4) Sequence: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-...

    Shanghai Doublewin Bio-Tech Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap Growth Hormone Peptides Exenatide Acetate Lyophilized Powder CAS 141732-76-5 product

    Brand Name:ND

    Model Number:141732-76-5

    Place of Origin:China

    ...Growth Hormone Peptides Exenatide Acetate Lyophilized Powder CAS 141732-76-5 Basic info: Product name: Exendin-4 Alias: Exenatide Acetate CAS No.: 141758-74-9 EINECS: 204-035-4 Storage: Shading, confined preservation Place of Origin: SHANGHAI, China...

    Doublewin Biological Technology Co., Ltd.
    Verified Supplier

    Guangxi

    Buy cheap Glucose Control High Purity Growth Hormone Peptides Exenatide Acetate Lyophilized Powder 141732-76-5 product

    Brand Name:Doublewin

    Model Number:Exenatide acetate

    Place of Origin:China

    ...Basic info: Exenatide acetate Synonyms: EXENATIDE ACETATE;ENFUVIRTIDE ACETATE;Exenatide; CAS: 141732-76-5 MF: C186H284N50O62S MW: 4244.60796 Purity : 99.0%min. Appearance: White powder Product Categories: Peptide;Agonist;...

    Shanghai Doublewin Bio-Tech Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap Peptide synthesis  API powder Exenatide Acetate /  Exenatida  CAS 141732-76-5 product

    Brand Name:Youngshe Peptide

    Model Number:Cas No:141732-76-5

    Place of Origin:China

    ...Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu youngshe chemical Co,.Ltd
    Active Member

    Buy cheap Exenatide acetate 141732-76-5 product

    Categories:API Chemical

    Telephone:86-27-59207850

    Country/Region:china

    Product name:Exenatide acetate CAS:141732-76-5 Appearance:White powder Molecular Formula:C184H282N50O60S Molecular Weight:4186.6

    WuHan Fortuna Chemical Co., Ltd
    Active Member

    Hubei

    Buy cheap cGMP peptide Octreotide Acetate cas no 79517-01-4 product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ... CAS No. Octreotide Acetate 79517-01-4 Leuprorelin Acetate 74381-53-6 Glatiramer Acetate 147245-92-9 Bivalirudin 128270-60-0 Triptorelin Acetate 57773-63-4 Terlipressin Acetate 52232-67-4 Desmopressin Acetate 16679-58-6 Exenatide Acetate 141732-76...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap Exenatide Acetate | Exenatide | CAS 141732-76-5 product

    Categories:Rutile Titanium Dioxide

    Telephone:+86-202-96321452

    Country/Region:china

    ...Exenatide Acetate | Exenatide | CAS 141732-76-5 ADD TIME: 2016-09-20 13:19:03 view count: 197clicks product info Exenatide Acetate /Exenatide/141732-76-5 1.Product Name : Exenatide Acetate /Exenatide/141732-76-5 2.Appearance :White powder 3....

    chinafactorys company
    ICP Remarked Supplier

    Buy cheap High Specification Exenatide Acetate CAS 141732-76-5 product

    Categories:High Purity Nitrogen Generator

    Telephone:86-576-88851661

    Country/Region:china

    High Specification Exenatide Acetate CAS 141732-76-5 High Specification Exenatide Acetate CAS 141732-76-5 Share to Payment Type: T/T,L/C Min. Order: 1 Gram Delivery Time: 10 Days Mr. Tommy Chat Now Contact Now Add to Basket

    Conbottpharm limited
    ICP Remarked Supplier

    Buy cheap Exenatide Acetate product

    Place of Origin:China

    Brand Name:GLS

    ...-Ala-Pro-Pro-Pro-Ser-NH2 Purity(HPLC):98.0%min. Cat #:52143 Appearance:White powder CAS.NO:141732-76-5 MSDS:MSDS Single Impurity(HPLC): Mass balance: Peptide Content(N%): Water content(Karl Fischer): Acid

    GL Biochem (Shanghai) Ltd
    Active Member

    Shanghai

    Buy cheap exenatide Acetate CAS.141732-76-5 product

    Brand Name:YS

    Model Number:YSAP

    Place of Origin:China

    ...Exenatide Acetate Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu YoungShe Chemical Co.,Ltd
    Site Member

    Sichuan

    Buy cheap Exenatide acetate CAS:141732-76-5 / sucy@chembj.com product

    Place of Origin:China

    Brand Name:Huao

    Model Number:sucy@chembj.com

    ... E -mail:sucy@ycphar.com Whatsapp:+8613419639982 http://www.servechemical.com / www.providepharmacy.com Exenatide acetate CAS:141732-76-5 Product Name:Exenatide acetate Synonyms:EXENATIDE ACETATE;ENFUVIRTIDE ACETATE;Exenatide;His-Gly-Gly-Gly-Thr...

    Guangzhou Huao Chemical Co,Ltd
    Site Member

    Guangdong

    Buy cheap Exenatide Acetate product

    Place of Origin:China

    ...Molecular Formula: C187H282N50O60S Molecular Weight: 4186.6 CAS No.: 141732-76-5 SPECIFICATIONS: 1 .Appearance : White powder 2 .Water Content( Karl Fischer) : d5.0% 3 .Acetate Content( by HPLC) : d12.0% 4 .Amino ...

    Chengdu Kaijie Biopharm Co. Ltd.
    Active Member

    Sichuan

    Buy cheap Exenatide acetate 141732-76-5 product

    Categories:Pharmaceutical intermediates

    Telephone:86-27-59207850

    Country/Region:china

    Product name:Exenatide acetate CAS:141732-76-5 Molecular Formula:C184H282N50O60S Molecular Weight:4186.6

    WuHan Fortuna Chemical Co., Ltd
    Active Member

    Hubei

    Buy cheap cGMP peptide Glatiramer Acetate cas no 147245-92-9 product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ... CAS No. Octreotide Acetate 79517-01-4 Leuprorelin Acetate 74381-53-6 Glatiramer Acetate 147245-92-9 Bivalirudin 128270-60-0 Triptorelin Acetate 57773-63-4 Terlipressin Acetate 52232-67-4 Desmopressin Acetate 16679-58-6 Exenatide Acetate 141732-76...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap cGMP peptide 128270-60-0 cas no Bivalirudin product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ... CAS No. Octreotide Acetate 79517-01-4 Leuprorelin Acetate 74381-53-6 Glatiramer Acetate 147245-92-9 Bivalirudin 128270-60-0 Triptorelin Acetate 57773-63-4 Terlipressin Acetate 52232-67-4 Desmopressin Acetate 16679-58-6 Exenatide Acetate 141732-76...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap cGMP peptide Exenatide Acetate cas no 141732-76-5 product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ...Product Name CAS No. Salcitonin Acetate 47931-85-1 Glucagon 16941-35-2 Pramlintide 196078-30-5 Sermorelin 86168-78-7 Deslorelin ...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap cGMP peptide Leuprorelin Acetate cas no 74381-53-6 product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ... CAS No. Octreotide Acetate 79517-01-4 Leuprorelin Acetate 74381-53-6 Glatiramer Acetate 147245-92-9 Bivalirudin 128270-60-0 Triptorelin Acetate 57773-63-4 Terlipressin Acetate 52232-67-4 Desmopressin Acetate 16679-58-6 Exenatide Acetate 141732-76...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap exenatide Acetate product

    Brand Name:YS

    Model Number:YSAP

    Place of Origin:China

    ...Exenatide Acetate Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu YoungShe Chemical Co.,Ltd
    Site Member

    Sichuan

    Go to Page
    Inquiry Cart 0