Sign In | Join Free | My ismap.com
ismap.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Basic Organic Chemicals > Organic Salt >

Cas No 141732 76 5

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cas no 141732 76 5

    All cas no 141732 76 5 wholesalers & cas no 141732 76 5 manufacturers come from members. We doesn't provide cas no 141732 76 5 products or service, please contact them directly and verify their companies info carefully.

    Total 130 products from cas no 141732 76 5 Manufactures & Suppliers
    Buy cheap Reseach Grade Peptide Deslorelin powder CAS 57773-65-6 98% for horse product

    Brand Name:vanz

    Model Number:powder

    Place of Origin:Wuhan China

    ...-65-6 Basic information Molecular formula: C64H83N17O12 Molar Mass: 1282.45 CAS number: 57773-65-6 Introduction Deslorelin is a synthetic hormone that stimulates the release of the pituitary ...

    Wuhan Vanz Pharm Inc.
    Verified Supplier

    Hubei

    Buy cheap Legal Ipamorelin Peptide Protein Hormones CAS 170851-70-4 No Side Effect product

    Brand Name:shinrezing

    Model Number:170851-70-4

    Place of Origin:China

    ...Product Description 99% Purity Bodybuilding Peptide powder CAS: 170851-70-4 Ipamorelin Ipamorelin details: Product Name:Ipamorelin Ipamorelin CAS No.: 170851-70-4 Ipamorelin Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2 Ipamorelin Purity (HPLC...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Clomiphene Citrate Powder Legal Anabolic Steroids CAS 50-41-9 Clomiphene 50mg Pills product

    Brand Name:Clomiphene

    Model Number:CAS 50-41-9

    Place of Origin:Hubei, China

    ...Factory Clomiphene Citrate Powder Selling CAS 50-41-9 Clomiphene 50mg Pills What is Clomiphene? Clomifene, also known as clomiphene, is a medication ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap Health Care DSIP CAS 62568-57-4 Human Growth Hormone Peptide for Well Sleep / Delta Sleep - Inducing product

    Brand Name:YIHAN

    Model Number:DSIP

    Place of Origin:China

    ...-ALA-SER-GLY-GLU 4H2O;DELTA SLEEP INDUCING PEPTIDE;DELTA SLEEP-INDUCING PEPTIDE 4H2O;DSIP CAS: 62568-57-4 MF: C35H48N10O15 MW: 848.81 Bodybuilding drug,Muscle building drug,Sex enhancement drug...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap CAS 221231-10-3 Human Growth Hormone Peptide Somatropin Injection 2iu / Vial product

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ... Description Frag 176-191 Synonyms: Fragment 177-191, AOD-9604 MF: C78H123N23O23S2 MW: 1815.08152 CAS:221231-10-3 Appearance: White Powder Purity: 99% Grade: Pharmaceutical Grade Storage: Closed, below 2 ~ 8 C preservation Usage...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Buy cheap Prevent Hair Loss Lyophilized Powder Copper Peptide CAS 49557 75 7 GHK - CU product

    Brand Name:BIOF

    Model Number:49557-75-7

    Place of Origin:Xi'an , China

    ...-75-7 GHK - CU What Is Copper Peptide ? Name: GHK-Cu (Copper peptide) CAS: 49557-75-7 Formula : Gly-His-Lys-2Cu Appearance: blue powder purity; 98%MIN Assay: HPLC;...

    Xi'an Biof Bio-technology Co.,Ltd
    Verified Supplier

    Buy cheap cGMP peptide Exenatide Acetate cas no 141732-76-5 product

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ...Product Name CAS No. Salcitonin Acetate 47931-85-1 Glucagon 16941-35-2 Pramlintide 196078-30-5 Sermorelin 86168-78-7 Deslorelin ...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Buy cheap Peptide synthesis  API powder Exenatide Acetate /  Exenatida  CAS 141732-76-5 product

    Brand Name:Youngshe Peptide

    Model Number:Cas No:141732-76-5

    Place of Origin:China

    ...Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu youngshe chemical Co,.Ltd
    Active Member

    Buy cheap Exenatide Acetate Custom Peptide Synthesis CAS 141732-76-5 Treatment Diabetes Mellitus Type 2 product

    Categories:Peptide APIs

    Country/Region:china

    ...hemical name: Exenatide Acetate Synonyms: Exendin-4; CAS Number: 141732-76-5 Possible CAS #: freebase: 141758-74-9 Appearance: White to Off-White Solid Melting Point: >209°C (dec.) Mol. Weight: ...

    HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD
    Active Member

    Zhejiang

    Buy cheap Exendin-4, Exenatide, 141732-76-5, 141758-74-9 product

    Brand Name:cellmano

    Model Number:E-0902

    Place of Origin:china

    ...-Gly-Ala-Pro-Pro-Pro-Ser-NH2 E-0902 Exendin-4, Exenatide C184H282N50O60S 4186.60 141758-74-9/141732-76-5 H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu...

    Cellmano Biotech Limited
    Active Member

    Buy cheap exenatide Acetate CAS.141732-76-5 product

    Brand Name:YS

    Model Number:YSAP

    Place of Origin:China

    ...Exenatide Acetate Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu YoungShe Chemical Co.,Ltd
    Site Member

    Sichuan

    Buy cheap Exenatide acetate CAS:141732-76-5 / sucy@chembj.com product

    Place of Origin:China

    Brand Name:Huao

    Model Number:sucy@chembj.com

    ... E -mail:sucy@ycphar.com Whatsapp:+8613419639982 http://www.servechemical.com / www.providepharmacy.com Exenatide acetate CAS:141732-76-5 Product Name:Exenatide acetate Synonyms:EXENATIDE ACETATE;ENFUVIRTIDE ACETATE;Exenatide;His-Gly-Gly-Gly-Thr...

    Guangzhou Huao Chemical Co,ltd
    Site Member

    Guangdong

    Buy cheap Exenatide Aceta Cas No 141732-76-5 product

    Categories:Pharmaceutical Chemicals

    Telephone:86-717-6307500

    Country/Region:china

    1 Appearance White powder White powder 2 Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml Conforms 3 Amino Acid Composition ±10% of theoretical Conforms 4 Peptide Purity (By HPLC) ≥ 98.0% by area integration 99.1% 5 ...

    Onicon Group
    ICP Remarked Supplier

    Hubei

    Buy cheap Exenatide Acetate | Exenatide | CAS 141732-76-5 product

    Categories:Rutile Titanium Dioxide

    Telephone:+86-202-96321452

    Country/Region:china

    ...Exenatide Acetate | Exenatide | CAS 141732-76-5 ADD TIME: 2016-09-20 13:19:03 view count: 197clicks product info Exenatide Acetate /Exenatide/141732-76-5 1.Product Name : Exenatide Acetate /Exenatide/141732-76-5 2.Appearance :White powder 3....

    chinafactorys company
    ICP Remarked Supplier

    Buy cheap B1131Exenatide Acetate(141732-76-5) product

    Categories:Other Furniture Parts

    Telephone:+86-21-51991287, +86-10-80115555, 405768

    Country/Region:china

    ...: Extendin-4 Molecular Formula: C184H282N50O60S Molecular Weight: 4186.6 Appearance: White powder Solubility: Purity: >99% Storage: CAS No.: 141732-76-5 This product is intended for laboratory and research use only. It is not for human...

    Biochem Tek (Shanghai) Co., LTD,
    ICP Remarked Supplier

    Buy cheap High Specification Exenatide Acetate CAS 141732-76-5 product

    Categories:High Purity Nitrogen Generator

    Telephone:86-576-88851661

    Country/Region:china

    High Specification Exenatide Acetate CAS 141732-76-5 High Specification Exenatide Acetate CAS 141732-76-5 Share to Payment Type: T/T,L/C Min. Order: 1 Gram Delivery Time: 10 Days Mr. Tommy Chat Now Contact Now Add to Basket

    Conbottpharm limited
    ICP Remarked Supplier

    Buy cheap Exenatide acetate CAS:141732-76-5 / sucy@chembj.com product

    Place of Origin:China

    Brand Name:Huao

    Model Number:sucy@chembj.com

    ... E -mail:sucy@ycphar.com Whatsapp:+8613419639982 http://www.servechemical.com / www.providepharmacy.com Exenatide acetate CAS:141732-76-5 Product Name:Exenatide acetate Synonyms:EXENATIDE ACETATE;ENFUVIRTIDE ACETATE;Exenatide;His-Gly-Gly-Gly-Thr...

    Guangzhou Huao Chemical Co,Ltd
    Site Member

    Guangdong

    Buy cheap Exenatide acetate 141732-76-5 product

    Categories:API Chemical

    Telephone:86-27-59207850

    Country/Region:china

    Product name:Exenatide acetate CAS:141732-76-5 Appearance:White powder Molecular Formula:C184H282N50O60S Molecular Weight:4186.6

    WuHan Fortuna Chemical Co., Ltd
    Active Member

    Hubei

    Buy cheap 99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 product

    Brand Name:Muscle Man

    Model Number:CAS:158861-67-7

    Place of Origin:Hunan,China

    ...99% Assay Protein Peptide Hormones 5mg/vials GHRP-2 For Bodybuilding CAS 158861-67-7 Quick Details: CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular weight: 746.91 Peptide purity: >98.0% Appearance: White Lyophilized ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    Buy cheap White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer product

    Brand Name:Youngshe

    Model Number:High quality

    Place of Origin:China

    ...White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic ...

    Chengdu YoungShe Chemical Co., Ltd
    Site Member

    Sichuan

    Go to Page
    Inquiry Cart 0